Structure of PDB 6e4p Chain B Binding Site BS01

Receptor Information
>6e4p Chain B (length=69) Species: 5691 (Trypanosoma brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMRVQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPEDAA
RAITELQASELEGATLFLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6e4p The RRM of the kRNA-editing protein TbRGG2 uses multiple surfaces to bind and remodel RNA.
Resolution1.949 Å
Binding residue
(original residue number in PDB)		W215 K219 F230 C231
Binding residue
(residue number reindexed from 1)		W15 K19 F30 C31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6e4p, PDBe:6e4p, PDBj:6e4p
PDBsum6e4p
PubMed30544166
UniProtQ389P7

[Back to BioLiP]