Structure of PDB 6drt Chain B Binding Site BS01

Receptor Information
>6drt Chain B (length=228) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLSKDTTALLKNFATINSGIMLKSGQFIMTRAVNGTTYAEANISDVIDF
DVAIYDLNGFLGILSLVNDDAEISQSEDGNIKIADARSTIFWPAADPSTV
VAPNKPIPFPVASAVTEIKAEDLQQLLRVSRGLQIDTIAITVKEGKIVIN
GFNKVEDSALTRVKYSLTLGDYDGENTFNFIINMANMKMQPGNYKLLLWA
KGKQGAAKFEGEHANYVVALEADSTHDF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6drt T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.
Resolution2.117 Å
Binding residue
(original residue number in PDB)		R1032 G1036 Y1039 K1105 I1107 V1217 A1219
Binding residue
(residue number reindexed from 1)		R32 G36 Y39 K105 I107 V217 A219
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0030337 DNA polymerase processivity factor activity
Biological Process
GO:0006260 DNA replication
GO:0019083 viral transcription
GO:0039686 bidirectional double-stranded viral DNA replication
GO:0039693 viral DNA genome replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6drt, PDBe:6drt, PDBj:6drt
PDBsum6drt
PubMed30169742
UniProtP04525|CLAMP_BPT4 Sliding clamp (Gene Name=45)

[Back to BioLiP]