Structure of PDB 6do1 Chain B Binding Site BS01

Receptor Information
>6do1 Chain B (length=304) Species: 562,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMK
LKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASV
SFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGL
ASLPAIIHRNVFFIENTNITVCAFHYESTLPIGLGLTKNILGFLFPFLII
LTSYTLIWKALKKAYDLEDNRNDDIFKIIMAIVLFFFFSWIPHQIFTFLD
VLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYF
LQLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6do1 Distinctive Activation Mechanism for Angiotensin Receptor Revealed by a Synthetic Nanobody.
Resolution2.901 Å
Binding residue
(original residue number in PDB)		Q15 D16 D17 W84 Y87 Y92 V108 R167 A181 F182 H183 Y184 K199 H355 D362 D380 M383 I387
Binding residue
(residue number reindexed from 1)		Q7 D8 D9 W76 Y79 Y84 V100 R159 A173 F174 H175 Y176 K188 H243 D250 D268 M271 I275
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004945 angiotensin type II receptor activity
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0019229 regulation of vasoconstriction
GO:0022900 electron transport chain
Cellular Component
GO:0016020 membrane
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6do1, PDBe:6do1, PDBj:6do1
PDBsum6do1
PubMed30639100
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
P30556

[Back to BioLiP]