Structure of PDB 6dnq Chain B Binding Site BS01

Receptor Information
>6dnq Chain B (length=87) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKV
EGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRL
Ligand information
>6dnq Chain A (length=24) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EDPEKEKRIKELELLLMSTEELKG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dnq Structural basis for cooperative regulation of KIX-mediated transcription pathways by the HTLV-1 HBZ activation domain.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		L599 H602 L603 K606 R646 Y650 H651 A654 Y658 Q661 K662 E665
Binding residue
(residue number reindexed from 1)		L14 H17 L18 K21 R61 Y65 H66 A69 Y73 Q76 K77 E80
Enzymatic activity
Enzyme Commision number 2.3.1.-
2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0003712 transcription coregulator activity
GO:0004402 histone acetyltransferase activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6dnq, PDBe:6dnq, PDBj:6dnq
PDBsum6dnq
PubMed30232260
UniProtP45481|CBP_MOUSE Histone lysine acetyltransferase CREBBP (Gene Name=Crebbp)

[Back to BioLiP]