Structure of PDB 6dig Chain B Binding Site BS01

Receptor Information

>6dig Chain B (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPEDFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTP
QGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTIS
PSNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVM
LEMTPQRGDVYTCHVEHPSLQSPITVEWRA

Ligand information

>6dig Chain C (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AGNHAAGILTLGK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6dig In vivo clonal expansion and phenotypes of hypocretin-specific CD4+T cells in narcolepsy patients and controls.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	F11 Y30 Y37 Y47 D57 Y60 W61 E74 T77 V78 H81 N82
Binding residue (residue number reindexed from 1)	F9 Y28 Y35 Y45 D55 Y58 W59 E72 T75 V76 H79 N80

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6dig, PDBe:6dig, PDBj:6dig
PDBsum	6dig
PubMed	31748512
UniProt	Q5SU54

[Back to BioLiP]