Structure of PDB 6dg0 Chain B Binding Site BS01

Receptor Information
>6dg0 Chain B (length=84) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAASTLFVANLSAEVNEDTLRGVFKAFSGFTRLRLHNKNGSAVAFVEYSD
LQKATQAMISLQGFQTANDRGGLRIEYARNKMAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dg0 Structure of MEC-8 RRM2 in complex with AGCACA
Resolution2.457 Å
Binding residue
(original residue number in PDB)		F24 A26 H53 F62 R92 E94 A96 R97 K99 M100 A101
Binding residue
(residue number reindexed from 1)		F7 A9 H36 F45 R74 E76 A78 R79 K81 M82 A83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6dg0, PDBe:6dg0, PDBj:6dg0
PDBsum6dg0
PubMed
UniProtG5ECJ4

[Back to BioLiP]