Structure of PDB 6dei Chain B Binding Site BS01

Receptor Information
>6dei Chain B (length=105) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSGGSSDDYSIMDYKL
GFVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIA
KSLNK
Ligand information
>6dei Chain C (length=24) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SNAFGGTLKLKKRLESVPELFLHD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dei The budding-yeast RWD protein Csm1 scaffolds diverse protein complexes through a conserved structural mechanism.
Resolution1.699 Å
Binding residue
(original residue number in PDB)		F122 T130 L165
Binding residue
(residue number reindexed from 1)		F52 T54 L89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0033551 monopolin complex

View graph for
Cellular Component
External links
PDB RCSB:6dei, PDBe:6dei, PDBj:6dei
PDBsum6dei
PubMed30252178
UniProtP25651|CSM1_YEAST Monopolin complex subunit CSM1 (Gene Name=CSM1)

[Back to BioLiP]