Structure of PDB 6dco Chain B Binding Site BS01

Receptor Information
>6dco Chain B (length=146) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYR
RAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCV
ESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNN
Ligand information
>6dco Chain D (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DMENLSRRLKVTGDLFDIMSG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dco Structural insights into BCL2 pro-survival protein interactions with the key autophagy regulator BECN1 following phosphorylation by STK4/MST1.
Resolution2.198 Å
Binding residue
(original residue number in PDB)		E96 F97 Y101 F105 L108 V126 E129 L130 D133 N136 G138 R139 Y195
Binding residue
(residue number reindexed from 1)		E44 F45 Y49 F53 L56 V74 E77 L78 D81 N84 G86 R87 Y143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6dco, PDBe:6dco, PDBj:6dco
PDBsum6dco
PubMed30626284
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]