Structure of PDB 6dcl Chain B Binding Site BS01

Receptor Information
>6dcl Chain B (length=171) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGF
GFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKI
FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDKRGFAFVTFDDHDSVDKI
VIQKYHTVNGHNCEVRKALSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dcl Structural basis for terminal loop recognition and stimulation of pri-miRNA-18a processing by hnRNP A1.
Resolution2.497 Å
Binding residue
(original residue number in PDB)		K106 F108 G110 G111 M137 K145 R146 F148 F150 E176 R178 L181
Binding residue
(residue number reindexed from 1)		K99 F101 G103 G104 M130 K133 R134 F136 F138 E164 R166 L169
Binding affinityPDBbind-CN: Kd=15.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6dcl, PDBe:6dcl, PDBj:6dcl
PDBsum6dcl
PubMed29946118
UniProtP09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Gene Name=HNRNPA1)

[Back to BioLiP]