Structure of PDB 6d6r Chain B Binding Site BS01

Receptor Information
>6d6r Chain B (length=241) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVY
GPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQL
RQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPM
RDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDA
RLHEDHLERVLEAAAQAARDVHTLLDRVVRQHVREASILLG
Ligand information
>6d6r Chain O (length=48) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tctttacggtgctcaccacaccacacacaccacaccacacaaaaaaaa
................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6d6r Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
Resolution3.45 Å
Binding residue
(original residue number in PDB)		L3 T82 E84 K86 H174
Binding residue
(residue number reindexed from 1)		L1 T80 E82 K84 H172
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003723 RNA binding
GO:0004532 RNA exonuclease activity
GO:0005515 protein binding
GO:0035925 mRNA 3'-UTR AU-rich region binding
Biological Process
GO:0000460 maturation of 5.8S rRNA
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0006401 RNA catabolic process
GO:0016075 rRNA catabolic process
GO:0030307 positive regulation of cell growth
GO:0034475 U4 snRNA 3'-end processing
GO:0045006 DNA deamination
GO:0051607 defense response to virus
GO:0071028 nuclear mRNA surveillance
GO:0071044 histone mRNA catabolic process
GO:0071051 poly(A)-dependent snoRNA 3'-end processing
Cellular Component
GO:0000176 nuclear exosome (RNase complex)
GO:0000177 cytoplasmic exosome (RNase complex)
GO:0000178 exosome (RNase complex)
GO:0000791 euchromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0043231 intracellular membrane-bounded organelle
GO:0101019 nucleolar exosome (RNase complex)
GO:1902494 catalytic complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6d6r, PDBe:6d6r, PDBj:6d6r
PDBsum6d6r
PubMed29906447
UniProtQ9NPD3|EXOS4_HUMAN Exosome complex component RRP41 (Gene Name=EXOSC4)

[Back to BioLiP]