Structure of PDB 6d3o Chain B Binding Site BS01

Receptor Information
>6d3o Chain B (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCN
DEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6d3o High-Resolution Structures for a Complex Between a Non-Helical Foldamer and VEGF
Resolution3.1 Å
Binding residue
(original residue number in PDB)		F17 Y21 Y25 N62 L66
Binding residue
(residue number reindexed from 1)		F5 Y9 Y13 N50 L54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008083 growth factor activity
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6d3o, PDBe:6d3o, PDBj:6d3o
PDBsum6d3o
PubMed
UniProtP15692|VEGFA_HUMAN Vascular endothelial growth factor A, long form (Gene Name=VEGFA)

[Back to BioLiP]