Structure of PDB 6ct7 Chain B Binding Site BS01

Receptor Information
>6ct7 Chain B (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYELTQPPSVSVSPGQTARITCSGEALPMQFAHWYQQRPGKAPVIVVYKD
SERPSGVPERFSGSSSGTTATLTITGVQAEDEADYYCQSPDSTNTYEVFG
GGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW
KADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHE
GSTVEKTVAPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ct7 Development of an aggregate-selective, human-derived alpha-synuclein antibody BIIB054 that ameliorates disease phenotypes in Parkinson's disease models.
Resolution1.903 Å
Binding residue
(original residue number in PDB)		L27 M29 Q30 F31 H33 Y48 K49 D50
Binding residue
(residue number reindexed from 1)		L27 M29 Q30 F31 H33 Y48 K49 D50
External links