Structure of PDB 6cl1 Chain B Binding Site BS01

Receptor Information
>6cl1 Chain B (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQI
LTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cl1 Selective and Rapid Cell-Permeable Inhibitor of Human Caspase-3.
Resolution2.651 Å
Binding residue
(original residue number in PDB)		Y230 S231 W232 R233
Binding residue
(residue number reindexed from 1)		Y19 S20 W21 R22
Enzymatic activity
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6cl1, PDBe:6cl1, PDBj:6cl1
PDBsum6cl1
PubMed31334631
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]