Structure of PDB 6cl0 Chain B Binding Site BS01

Receptor Information
>6cl0 Chain B (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQ
YADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYF
YHLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cl0 Selective and Rapid Cell-Permeable Inhibitor of Human Caspase-3.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		Y204 S205 W206 R207 N208 S209 S249 F250 F256
Binding residue
(residue number reindexed from 1)		Y29 S30 W31 R32 N33 S34 S74 F75 F81
Enzymatic activity
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6cl0, PDBe:6cl0, PDBj:6cl0
PDBsum6cl0
PubMed31334631
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]