Structure of PDB 6c6k Chain B Binding Site BS01

Receptor Information
>6c6k Chain B (length=454) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHN
LLAYVKHLKGQNEEALKSLKEAENLMQNVRSLVTWGNFAWMYYHMGRLAE
AQTYLDKVENICKSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFE
KVLEVDPENPESSAGYAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPD
NGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKG
SVDKALELLKKALQETPTSVLLHHQIGLCYKAQMIQIKEATKGQPRGQNR
EKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAEENFQK
LLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTR
DKSINSLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALR
LAAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c6k Human IFIT3 Modulates IFIT1 RNA Binding Specificity and Protein Stability.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		R40 Q44 L48 T50 W149 L152 K153 G156 Y159 I185 R189 F193 N218 Y220 Y254 R257 Y258 K261 R265 L288 H291 Q292 I302 K338 F341 E354 R388 F392 K426
Binding residue
(residue number reindexed from 1)		R32 Q36 L40 T42 W132 L135 K136 G139 Y142 I168 R172 F176 N201 Y203 Y237 R240 Y241 K244 R248 L271 H274 Q275 I285 K321 F324 E337 R371 F375 K409
Binding affinityPDBbind-CN: Kd=49.1nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0009615 response to virus
GO:0019060 intracellular transport of viral protein in host cell
GO:0032091 negative regulation of protein binding
GO:0045070 positive regulation of viral genome replication
GO:0045071 negative regulation of viral genome replication
GO:0045087 innate immune response
GO:0051097 negative regulation of helicase activity
GO:0051607 defense response to virus
GO:0051707 response to other organism
GO:0071357 cellular response to type I interferon
GO:0071360 cellular response to exogenous dsRNA
GO:0140374 antiviral innate immune response
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0043657 host cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c6k, PDBe:6c6k, PDBj:6c6k
PDBsum6c6k
PubMed29525521
UniProtP09914|IFIT1_HUMAN Interferon-induced protein with tetratricopeptide repeats 1 (Gene Name=IFIT1)

[Back to BioLiP]