Structure of PDB 6c2s Chain B Binding Site BS01

Receptor Information
>6c2s Chain B (length=142) Species: 258594 (Rhodopseudomonas palustris CGA009) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SELKMGELSELLGYALKRAQLRVFEDFLHCVAPVQLTPAQFSVLLLLDAN
PGRNQTEIATTLGILRPNFVAMLDALEGRGLCVRTRSPSDRRSHILMLTD
KGRATLARAKKLVATRHEDRLTELLGRDNRDALLSMLATIAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c2s Structural basis of transcriptional regulation by CouR, a repressor of coumarate catabolism, inRhodopseudomonas palustris.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		L104 P106 N107 D129 R130 R131
Binding residue
(residue number reindexed from 1)		L65 P67 N68 D90 R91 R92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6c2s, PDBe:6c2s, PDBj:6c2s
PDBsum6c2s
PubMed29794028
UniProtQ6N8V9

[Back to BioLiP]