Structure of PDB 6c1y Chain B Binding Site BS01

Receptor Information
>6c1y Chain B (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAY
FEKVGDTSLDPNDFDFTVTGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c1y Plasticity at the DNA recognition site of the MeCP2 mCG-binding domain.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
R133 S134 V136 T158 V159
Binding residue
(residue number reindexed from 1)
R42 S43 V45 T67 V68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6c1y, PDBe:6c1y, PDBj:6c1y
PDBsum6c1y
PubMed31356990
UniProtP51608|MECP2_HUMAN Methyl-CpG-binding protein 2 (Gene Name=MECP2)

[Back to BioLiP]