Structure of PDB 6c1r Chain B Binding Site BS01

Receptor Information
>6c1r Chain B (length=371) Species: 562,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAKDFRHGFDILVG
QIDDALKLANEGKVKEAQAAAEQLKTTRNAYSNTLRVPDILALVIFAVVF
LVGVLGNALVVWVTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQ
HHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFKPIWCQNFR
GAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRR
ERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRSTKTLKVVVAVVASF
FIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIYV
VAGQGFKSLPSLLRNVLTEES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c1r Orthosteric and allosteric action of the C5a receptor antagonists.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
L178 S181 P199 R261 R264 C274 G275 V276 S279 Y344 G348 M351 K365 D368 V372
Binding residue
(residue number reindexed from 1)
L144 S147 P165 R227 R230 C240 G241 V242 S245 Y307 G311 M314 K328 D331 V335
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004875 complement receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006935 chemotaxis
GO:0007186 G protein-coupled receptor signaling pathway
GO:0022900 electron transport chain
Cellular Component
GO:0016020 membrane
GO:0042597 periplasmic space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6c1r, PDBe:6c1r, PDBj:6c1r
PDBsum6c1r
PubMed29867214
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
P21730|C5AR1_HUMAN C5a anaphylatoxin chemotactic receptor 1 (Gene Name=C5AR1)

[Back to BioLiP]