Structure of PDB 6c1a Chain B Binding Site BS01

Receptor Information
>6c1a Chain B (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL
GNTVDLSSFDFRTGKMM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c1a Structural basis for the ability of MBD domains to bind methyl-CG and TG sites in DNA.
Resolution2.05 Å
Binding residue
(original residue number in PDB)
R166 S168 G169 L170 S171 M214
Binding residue
(residue number reindexed from 1)
R19 S21 G22 L23 S24 M67
Binding affinityPDBbind-CN: Kd=7.2uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6c1a, PDBe:6c1a, PDBj:6c1a
PDBsum6c1a
PubMed29567833
UniProtQ9UBB5|MBD2_HUMAN Methyl-CpG-binding domain protein 2 (Gene Name=MBD2)

[Back to BioLiP]