Structure of PDB 6c0y Chain B Binding Site BS01

Receptor Information
>6c0y Chain B (length=107) Species: 53446 (Streptomyces cinnamoneus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVDIIRRIQELMVLCSLLPPDGKLREALELALALHEEPALARITPLTNLH
PFATKAWLETLWLGEGVSSEEKELVAWQNKSENMGPAIRELKNAEQQSGI
TLVARLT
Ligand information
>6c0y Chain J (length=19) Species: 53446 (Streptomyces cinnamoneus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CKQACAFGPFPFVCDGNPK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c0y Substrate-assisted enzymatic formation of lysinoalanine in duramycin.
Resolution1.66 Å
Binding residue
(original residue number in PDB)		D12 V13 I16 R17 Q20
Binding residue
(residue number reindexed from 1)		D1 V2 I5 R6 Q9
Enzymatic activity
Enzyme Commision number ?
External links