Structure of PDB 6bqu Chain B Binding Site BS01

Receptor Information
>6bqu Chain B (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKI
RRKNCPACRYRKCLQAGMNLEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bqu General and sequence-specific roles for DNA in glucocorticoid receptor DNA-binding stoichiometry
Resolution2.5 Å
Binding residue
(original residue number in PDB)		G439 S440 V443 R447 Y455 R470 K471 R477
Binding residue
(residue number reindexed from 1)		G21 S22 V25 R29 Y37 R52 K53 R59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6bqu, PDBe:6bqu, PDBj:6bqu
PDBsum6bqu
PubMed
UniProtP04150|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]