Structure of PDB 6bmf Chain B Binding Site BS01

Receptor Information

>6bmf Chain B (length=285) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NKKLRGALSSAILSEKPNVKWEDVAGLEGAKEALKEAVILPVKFPHLFKG
NRKPTSGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESE
KLVKQLFAMARENKPSIIFIDEVDALTGTRGEGESEASRRIKTELLVQMN
GVGNDSQGVLVLGATNIPWQLDSAIRRRFERRIYIPLPDLAARTTMFEIN
VGDTPCVLTKEDYRTLGAMTEGYSGSDIAVVVKDALMQPIRKIQSAPDLT
IKDFLKAIKSTRPTVNEDDLLKQEQFTRDFGQEGN

Ligand information

>6bmf Chain G (length=8) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DEIVNKVL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6bmf The AAA ATPase Vps4 binds ESCRT-III substrates through a repeating array of dipeptide-binding pockets.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	K205 W206
Binding residue (residue number reindexed from 1)	K94 W95

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0016887	ATP hydrolysis activity

View graph for
Molecular Function

External links

PDB	RCSB:6bmf, PDBe:6bmf, PDBj:6bmf
PDBsum	6bmf
PubMed	29165244
UniProt	P52917\|VPS4_YEAST Vacuolar protein sorting-associated protein 4 (Gene Name=VPS4)

[Back to BioLiP]