Structure of PDB 6bhx Chain B Binding Site BS01

Receptor Information
>6bhx Chain B (length=98) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFEADFINCVTW
RRQAENVANFLKKGSLAGVDGRLQTRNYEQQGQRVFVTEVQAESVQFL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bhx Structural Mechanisms of Cooperative DNA Binding by Bacterial Single-Stranded DNA-Binding Proteins.
Resolution2.936 Å
Binding residue
(original residue number in PDB)		R10 L11 T12 A32 N34 T36 F37 F48
Binding residue
(residue number reindexed from 1)		R13 L14 T15 A35 N37 T39 F40 F44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6bhx, PDBe:6bhx, PDBj:6bhx
PDBsum6bhx
PubMed30472092
UniProtP37455|SSBA_BACSU Single-stranded DNA-binding protein A (Gene Name=ssbA)

[Back to BioLiP]