Structure of PDB 6bgg Chain B Binding Site BS01

Receptor Information
>6bgg Chain B (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSL
RDSNPDEIEIDFETLKPTTLRELERYVKSCLQKKQRKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bgg The BRD3 ET domain recognizes a short peptide motif through a mechanism that is conserved across chromatin remodelers and transcriptional regulators.
ResolutionN/A
Binding residue
(original residue number in PDB)		K577 R578 L592 D612 E613 I614 E615 I616 F618
Binding residue
(residue number reindexed from 1)		K21 R22 L36 D56 E57 I58 E59 I60 F62
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6bgg, PDBe:6bgg, PDBj:6bgg
PDBsum6bgg
PubMed29567837
UniProtQ15059|BRD3_HUMAN Bromodomain-containing protein 3 (Gene Name=BRD3)

[Back to BioLiP]