Structure of PDB 6bdv Chain B Binding Site BS01

Receptor Information
>6bdv Chain B (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMH
ILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bdv Modifications to a common phosphorylation network provide individualized control in caspases.
Resolution1.938 Å
Binding residue
(original residue number in PDB)
Y204 S205 W206 R207 N208 S209
Binding residue
(residue number reindexed from 1)
Y20 S21 W22 R23 N24 S25
Enzymatic activity
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6bdv, PDBe:6bdv, PDBj:6bdv
PDBsum6bdv
PubMed29414778
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]