Structure of PDB 6bd2 Chain B Binding Site BS01

Receptor Information
>6bd2 Chain B (length=230) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKN
VVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL
LDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQ
EAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAI
AELDTLNEDSYKDSTLIMQLLRDNLTLWTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bd2 Mechanism of IRSp53 inhibition by 14-3-3.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
K49 R56 R60 K120 R127 Y128 L172 N173 N224 L227 W228
Binding residue
(residue number reindexed from 1)
K49 R56 R60 K120 R127 Y128 L172 N173 N224 L227 W228
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019904 protein domain specific binding
GO:0042802 identical protein binding
GO:0044325 transmembrane transporter binding
GO:0071889 14-3-3 protein binding
Biological Process
GO:0006605 protein targeting
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0008104 protein localization
GO:0021762 substantia nigra development
GO:0034766 negative regulation of monoatomic ion transmembrane transport
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0045202 synapse
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6bd2, PDBe:6bd2, PDBj:6bd2
PDBsum6bd2
PubMed30696821
UniProtP27348|1433T_HUMAN 14-3-3 protein theta (Gene Name=YWHAQ)

[Back to BioLiP]