Structure of PDB 6bd1 Chain B Binding Site BS01

Receptor Information

>6bd1 Chain B (length=230) Species: 9606 (Homo sapiens)

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKN
VVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL
LDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQ
EAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAI
AELDTLNEDSYKDSTLIMQLLRDNLTLWTS

Ligand information

>6bd1 Chain D (length=6) Species: 9606 (Homo sapiens)

RSSSMA

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6bd1 Mechanism of IRSp53 inhibition by 14-3-3.
• Resolution: 2.35 Å
• Binding residue (original residue number in PDB): R56 R60 R127 Y128 L172 N173 E180 I217 N224 L227 W228
• Binding residue (residue number reindexed from 1): R56 R60 R127 Y128 L172 N173 E180 I217 N224 L227 W228

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0019904 protein domain specific binding
• GO:0042802 identical protein binding
• GO:0044325 transmembrane transporter binding
• GO:0071889 14-3-3 protein binding

Biological Process

• GO:0006605 protein targeting
• GO:0007165 signal transduction
• GO:0007264 small GTPase-mediated signal transduction
• GO:0008104 protein localization
• GO:0021762 substantia nigra development
• GO:0034766 negative regulation of monoatomic ion transmembrane transport
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:0045202 synapse
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:6bd1, PDBe:6bd1, PDBj:6bd1
• PDBsum: 6bd1
• PubMed: 30696821
• UniProt: P27348|1433T_HUMAN 14-3-3 protein theta (Gene Name=YWHAQ)