Structure of PDB 6bae Chain B Binding Site BS01

Receptor Information

>6bae Chain B (length=223) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQSPGKGLEWVAR
IYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAIYYCSRWG
GDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPCVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEPKSC

Ligand information

>6bae Chain D (length=12) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CQFDLSTRRLKC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6bae Template-Catalyzed, Disulfide Conjugation of Monoclonal Antibodies Using a Natural Amino Acid Tag.
Resolution	2.14 Å
Binding residue (original residue number in PDB)	Q39 P41 I93 Y95 Q112 E155 P174 C175
Binding residue (residue number reindexed from 1)	Q39 P41 I93 Y95 Q112 E155 P174 C175

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:6bae, PDBe:6bae, PDBj:6bae
PDBsum	6bae
PubMed	29763554
UniProt	S6B291

[Back to BioLiP]