Structure of PDB 6b9m Chain B Binding Site BS01

Receptor Information
>6b9m Chain B (length=148) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLIDPGFGFYKINEFVDARDLNMGAWFEAQIVKVTKTPAGGPEEIVYHVK
YEDYPENGVVQLRGKDVRPRARTVYQWRQLEPGMIVMVNYNPDDPKERGY
WYDAEIQRKRETRTQREVFGKILLGDAGDSLNDCRIMFVTEIYKIEEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b9m An Intramolecular Interaction of UHRF1 Reveals Dual Control for Its Histone Association.
Resolution1.68 Å
Binding residue
(original residue number in PDB)
F142 D144 F154 E155 E181 D182 R199 W230 Y272
Binding residue
(residue number reindexed from 1)
F15 D17 F27 E28 E52 D53 R70 W101 Y143
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:6b9m, PDBe:6b9m, PDBj:6b9m
PDBsum6b9m
PubMed29395786
UniProtE7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 (Gene Name=uhrf1)

[Back to BioLiP]