Structure of PDB 6b77 Chain B Binding Site BS01

Receptor Information
>6b77 Chain B (length=243) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPED
LTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDAD
GSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEA
QVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQ
AAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b77 Structures of human plasma beta-factor XIIa cocrystallized with potent inhibitors.
Resolution2.37 Å
Binding residue
(original residue number in PDB)		C122 Q204 A205 E205B R205C R206
Binding residue
(residue number reindexed from 1)		C114 Q200 A201 E203 R204 R205
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195
Catalytic site (residue number reindexed from 1) H40 D89 Q188 G189 D190 S191
Enzyme Commision number 3.4.21.38: coagulation factor XIIa.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6b77, PDBe:6b77, PDBj:6b77
PDBsum6b77
PubMed29519898
UniProtP00748|FA12_HUMAN Coagulation factor XII (Gene Name=F12)

[Back to BioLiP]