Structure of PDB 6avg Chain B Binding Site BS01

Receptor Information

>6avg Chain B (length=196) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AKTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGY
KTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVVDQKLVFGTGT
RLLVSPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYI
TDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS

Ligand information

>6avg Chain Q (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

APRGPHGGAASGL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6avg Divergent T-cell receptor recognition modes of a HLA-I restricted extended tumour-associated peptide.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	Y35 Q52
Binding residue (residue number reindexed from 1)	Y31 Q48

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:6avg, PDBe:6avg, PDBj:6avg
PDBsum	6avg
PubMed	29531227
UniProt	A0A0B4J268\|TVA4_HUMAN T cell receptor alpha variable 4 (Gene Name=TRAV4)

[Back to BioLiP]