Structure of PDB 6amk Chain B Binding Site BS01

Receptor Information

>6amk Chain B (length=51) Species: 54571 (Streptomyces venezuelae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PLLTPAEVATMFRVDPKTVTRWAKAGKLTSIRTMGGHRRYREAEVRALMA
G

Ligand information

>6amk Chain R (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttcaattcgggtaattcgggca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6amk The MerR-like protein BldC binds DNA direct repeats as cooperative multimers to regulate Streptomyces development.
Resolution	3.288 Å
Binding residue (original residue number in PDB)	P14 A15 K26 H46 R47
Binding residue (residue number reindexed from 1)	P5 A6 K17 H37 R38
Binding affinity	PDBbind-CN: Kd=16.5nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6amk, PDBe:6amk, PDBj:6amk
PDBsum	6amk
PubMed	29556010
UniProt	F2REK9

[Back to BioLiP]