Structure of PDB 6am0 Chain B Binding Site BS01

Receptor Information
>6am0 Chain B (length=175) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSTETLEIYRKALNFNVIARYDPKIKQLLFHTPHATVYKWGDDNWNKLEY
QGVLAIYLRDVGDKEAILPEVSSEANTPHVLTGHDIYNYGLIIMNRINPD
NFSLAIAPNSVLNKRKLFAPNREEELEPMKVEVRDDLVMIKTLKKEVYGI
WVHTPEDRQNIYELIKYLLENEPTD
Ligand information
>6am0 Chain C (length=23) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KCYAGATFATEAPQVTTLPKPSF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6am0 Structure of the activated Edc1-Dcp1-Dcp2-Edc3 mRNA decapping complex with substrate analog poised for catalysis.
Resolution2.84 Å
Binding residue
(original residue number in PDB)		H34 Y38 W40 W45 E142 R144 M149 W161 H163
Binding residue
(residue number reindexed from 1)		H34 Y38 W40 W45 E132 R134 M139 W151 H153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0008047 enzyme activator activity
Biological Process
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0031087 deadenylation-independent decapping of nuclear-transcribed mRNA
GO:0043085 positive regulation of catalytic activity
Cellular Component
GO:0000932 P-body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6am0, PDBe:6am0, PDBj:6am0
PDBsum6am0
PubMed29559651
UniProtQ6CPV9

[Back to BioLiP]