Structure of PDB 6a9c Chain B Binding Site BS01

Receptor Information
>6a9c Chain B (length=66) Species: 5759 (Entamoeba histolytica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSKLPQVKALYPYTAANDEELSFKVGDIITILEKDEGWWKGELNGQEGWI
PNNYVKEILEHHHHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a9c EhFP10: A FYVE family GEF interacts with myosin IB to regulate cytoskeletal dynamics during endocytosis in Entamoeba histolytica.
Resolution1.98 Å
Binding residue
(original residue number in PDB)		Y9 G35 W36 N51 Y52
Binding residue
(residue number reindexed from 1)		Y11 G37 W38 N53 Y54
Enzymatic activity
Enzyme Commision number ?
External links