Structure of PDB 6a8r Chain B Binding Site BS01

Receptor Information
>6a8r Chain B (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQN
RRARHPGQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a8r DUX4HD2-DNAERGstructure reveals new insight into DUX4-Responsive-Element.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		F25 R53
Binding residue
(residue number reindexed from 1)		F24 R52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6a8r, PDBe:6a8r, PDBj:6a8r
PDBsum6a8r
PubMed30315230
UniProtQ9UBX2|DUX4_HUMAN Double homeobox protein 4 (Gene Name=DUX4)

[Back to BioLiP]