Structure of PDB 6a8o Chain B Binding Site BS01

Receptor Information
>6a8o Chain B (length=236) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVGGTNASLGEWPWQVSLQVKLVSQTHLCGGSIIGRQWVLTAAHCFDGIP
YPDVWRIYGGILSLSEITKETPSSRIKELIIHQEYKVSEGNYDIALIKLQ
TPLNYTEFQKPISLPSKADTNTIYTNCWVTGWGYTKEQGETQNILQKATI
PLVPNEECQKKYRDYVINKQMICAGYKEGGTDACKGDSGGPLVCKHSGRW
QLVGITSWGEGCARKDQPGVYTKVSEYMDWILEKTQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a8o Crystal structure of plasma kallikrein reveals the unusual flexibility of the S1 pocket triggered by Glu217.
Resolution2.77 Å
Binding residue
(original residue number in PDB)		L41 T151 K192 S195 W215 G216
Binding residue
(residue number reindexed from 1)		L28 T141 K185 S188 W208 G209
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 K192 G193 D194 S195
Catalytic site (residue number reindexed from 1) H44 D93 K185 G186 D187 S188
Enzyme Commision number 3.4.21.34: plasma kallikrein.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6a8o, PDBe:6a8o, PDBj:6a8o
PDBsum6a8o
PubMed30019481
UniProtP26262|KLKB1_MOUSE Plasma kallikrein (Gene Name=Klkb1)

[Back to BioLiP]