Structure of PDB 6a8n Chain B Binding Site BS01

Receptor Information
>6a8n Chain B (length=245) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVGGEFTEVENQPWFAAIYQKNKSPPSFKCGGSLISPCWVASAAHCFIQL
PKKENYVVYLGQSKESSYNPGEMKFEVEQLILHEYYREDSLAYHNDIALL
KIRTSTGQCAQPSRSIQTIALPPRFTDAPFGSDCEITGFGKESESDYLYP
KNLKMSVVKLVSHEQCMQPHYYGSEINYKMLCAADPEWKTDSCKGDSGGP
LICNIEGRPTLSGIVSWGRGCAEKNKPGVYTRVSHFLDWIQSHIG
Ligand information
>6a8n Chain C (length=10) Species: 279974 (Phage display vector pTDisp) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CPAYSRYIGC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a8n Suppression of Tumor Growth and Metastases by Targeted Intervention in Urokinase Activity with Cyclic Peptides.
Resolution2.489 Å
Binding residue
(original residue number in PDB)
K41 H57 E96 S97A L97B A98 Y99 Y151 D189 S190 K192 S195 W215 G216 R217 G218
Binding residue
(residue number reindexed from 1)
K29 H45 E88 S90 L91 A92 Y93 Y149 D191 S192 K194 S197 W217 G218 R219 G220
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 K192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H45 D96 K194 G195 D196 S197 G198
Enzyme Commision number 3.4.21.73: u-plasminogen activator.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6a8n, PDBe:6a8n, PDBj:6a8n
PDBsum6a8n
PubMed30707839
UniProtP06869|UROK_MOUSE Urokinase-type plasminogen activator (Gene Name=Plau)

[Back to BioLiP]