Structure of PDB 6a5q Chain B Binding Site BS01

Receptor Information
>6a5q Chain B (length=232) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKN
VVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLEL
LDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQ
EAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAI
AELDTLNEESYKDSTLIMQLLRDNLTLWTSEN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a5q YWHA/14-3-3 proteins recognize phosphorylated TFEB by a noncanonical mode for controlling TFEB cytoplasmic localization.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
N40 R43 N44 S47 K51 R58 E115 R129 Y130 I168 L174 N175 E182 E211 D215 L222 N226 W230
Binding residue
(residue number reindexed from 1)
N38 R41 N42 S45 K49 R56 E113 R127 Y128 I166 L172 N173 E180 E209 D213 L220 N224 W228
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004860 protein kinase inhibitor activity
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0019904 protein domain specific binding
GO:0042802 identical protein binding
GO:0042826 histone deacetylase binding
GO:0045296 cadherin binding
GO:0050815 phosphoserine residue binding
GO:0051219 phosphoprotein binding
Biological Process
GO:0006605 protein targeting
GO:0007165 signal transduction
GO:0008104 protein localization
GO:0043085 positive regulation of catalytic activity
GO:0045744 negative regulation of G protein-coupled receptor signaling pathway
GO:0051220 cytoplasmic sequestering of protein
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005773 vacuole
GO:0005774 vacuolar membrane
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0042470 melanosome
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6a5q, PDBe:6a5q, PDBj:6a5q
PDBsum6a5q
PubMed30653408
UniProtP31946|1433B_HUMAN 14-3-3 protein beta/alpha (Gene Name=YWHAB)

[Back to BioLiP]