Structure of PDB 5zz9 Chain B Binding Site BS01

Receptor Information
>5zz9 Chain B (length=114) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEQPIFTTRAHVFQIDPSTKKNWVPASKQAVTVSYFYDVTRNSYRIISVD
GAKVIINSTITPNMTFTKTSQKFGQWADSRANTVFGLGFSSELQLTKFAE
KFQEVREAARLARD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zz9 Homer Tetramer Promotes Actin Bundling Activity of Drebrin.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		H18 F20 K28 W30 T76 S77 Q78 F80 Q82 G95 F96
Binding residue
(residue number reindexed from 1)		H11 F13 K21 W23 T69 S70 Q71 F73 Q75 G88 F89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035256 G protein-coupled glutamate receptor binding
Biological Process
GO:0007216 G protein-coupled glutamate receptor signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5zz9, PDBe:5zz9, PDBj:5zz9
PDBsum5zz9
PubMed30503778
UniProtQ9QWW1|HOME2_MOUSE Homer protein homolog 2 (Gene Name=Homer2)

[Back to BioLiP]