Structure of PDB 5zvm Chain B Binding Site BS01

Receptor Information
>5zvm Chain B (length=76) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALN
TLVKQLSSNFGAISSVLNDILSRLDK
Ligand information
>5zvm Chain a (length=29) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
INVTFLDLEYEMKKLEEAIKKLEESYIDL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zvm A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		N901 Q904 Q908 K911 A912 Q915 T922 K929 L930 V933 Q936 N937 A940
Binding residue
(residue number reindexed from 1)		N9 Q12 Q16 K19 A20 Q23 T30 K37 L38 V41 Q44 N45 A48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019064 fusion of virus membrane with host plasma membrane
GO:0039654 fusion of virus membrane with host endosome membrane
GO:0046813 receptor-mediated virion attachment to host cell
GO:0075509 endocytosis involved in viral entry into host cell
Cellular Component
GO:0016020 membrane
GO:0019031 viral envelope
GO:0055036 virion membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zvm, PDBe:5zvm, PDBj:5zvm
PDBsum5zvm
PubMed30989115
UniProtP59594|SPIKE_SARS Spike glycoprotein (Gene Name=S)

[Back to BioLiP]