Structure of PDB 5zva Chain B Binding Site BS01

Receptor Information

>5zva Chain B (length=185) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YFQGSAMDPPTFTFNFNNEPWVRGRHETYLCFTMEVVKHHSPVSWKRGVF
RNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVA
EFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKY
CWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE

Ligand information

>5zva Chain C (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

attttcaact

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5zva Crystal Structure of Cytidine Deaminase Human APOBEC3F Chimeric Catalytic Domain in Complex with DNA
Resolution	2.3 Å
Binding residue (original residue number in PDB)	W-9 V-8 H-4 W277 Y307 Y308 W310
Binding residue (residue number reindexed from 1)	W21 V22 H26 W89 Y119 Y120 W122
Binding affinity	PDBbind-CN: Kd=54.86uM

Enzymatic activity

Enzyme Commision number

3.5.4.38: single-stranded DNA cytosine deaminase.

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0008270	zinc ion binding
GO:0016787	hydrolase activity

View graph for
Molecular Function

External links

PDB	RCSB:5zva, PDBe:5zva, PDBj:5zva
PDBsum	5zva
PubMed
UniProt	Q8IUX4\|ABC3F_HUMAN DNA dC->dU-editing enzyme APOBEC-3F (Gene Name=APOBEC3F); Q9HC16\|ABC3G_HUMAN DNA dC->dU-editing enzyme APOBEC-3G (Gene Name=APOBEC3G)

[Back to BioLiP]