Structure of PDB 5zuu Chain B Binding Site BS01

Receptor Information
>5zuu Chain B (length=149) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHPLPQGVNRYFVVKSNNRENFELSVQQGVWATQRSNEAKLNEAFDSVEN
VILIFSVNRTRHFQGCAKMTSRIGWYGRNFSVKWLKLCELSFHKTRNLRN
PYNENLPVKISRDCQELEPSVGEQLASLLYLEPDSELMAISIAAEAKRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zuu CPSF30-L-mediated recognition of mRNA m6A modification controls alternative polyadenylation of nitrate signaling-related gene transcripts in Arabidopsis.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		K243 N245 N249 W259 A260 Q262 N286 R287 R289 W310 Y319 F335 K352 I353 S354 R355 D356
Binding residue
(residue number reindexed from 1)		K15 N17 N21 W31 A32 Q34 N58 R59 R61 W75 Y76 F92 K109 I110 S111 R112 D113
Enzymatic activity
Enzyme Commision number 3.1.21.-
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5zuu, PDBe:5zuu, PDBj:5zuu
PDBsum5zuu
PubMed33515769
UniProtA9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 (Gene Name=CPSF30)

[Back to BioLiP]