Structure of PDB 5zjr Chain B Binding Site BS01

Receptor Information
>5zjr Chain B (length=74) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVS
NWFGNKRIRYKKNIGKAQEEANLY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zjr Intrinsic DNA Shape Accounts for Affinity Differences between Hox-Cofactor Binding Sites.
Resolution3.03 Å
Binding residue
(original residue number in PDB)		R3 R6 Y29 R57
Binding residue
(residue number reindexed from 1)		R3 R6 Y29 R57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5zjr, PDBe:5zjr, PDBj:5zjr
PDBsum5zjr
PubMed30157419
UniProtP40427|EXD_DROME Homeobox protein extradenticle (Gene Name=exd)

[Back to BioLiP]