Structure of PDB 5zjq Chain B Binding Site BS01

Receptor Information
>5zjq Chain B (length=73) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSN
WFGNKRIRYKKNIGKAQEEANLY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zjq Intrinsic DNA Shape Accounts for Affinity Differences between Hox-Cofactor Binding Sites.
Resolution2.443 Å
Binding residue
(original residue number in PDB)		R4 R6 Y29 R57 I58 K61
Binding residue
(residue number reindexed from 1)		R3 R5 Y28 R56 I57 K60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5zjq, PDBe:5zjq, PDBj:5zjq
PDBsum5zjq
PubMed30157419
UniProtP40427|EXD_DROME Homeobox protein extradenticle (Gene Name=exd)

[Back to BioLiP]