Structure of PDB 5zgc Chain B Binding Site BS01

Receptor Information
>5zgc Chain B (length=258) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFDLPYPEAIFELPFF
FHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLER
VSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTG
VVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVR
SSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRD
LVQRETGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zgc Crystal Structure of SIRT3 in complex with H4K16bhb peptide
Resolution2.9 Å
Binding residue
(original residue number in PDB)		E177 F180 Q228 I230 H248 V292 F293 F294 G295 E296 L322 E323 V324 E325 P326 S329 P350 W353
Binding residue
(residue number reindexed from 1)		E42 F45 Q93 I95 H113 V157 F158 F159 G160 E161 L187 E188 V189 E190 P191 S194 P215 W218
Enzymatic activity
Catalytic site (original residue number in PDB) P155 D156 F157 N229 D231 H248
Catalytic site (residue number reindexed from 1) P34 D35 F36 N94 D96 H113
Enzyme Commision number 2.3.1.286: protein acetyllysine N-acetyltransferase.
Gene Ontology
Molecular Function
GO:0017136 NAD-dependent histone deacetylase activity
GO:0051287 NAD binding
GO:0070403 NAD+ binding

View graph for
Molecular Function
External links
PDB RCSB:5zgc, PDBe:5zgc, PDBj:5zgc
PDBsum5zgc
PubMed
UniProtQ9NTG7|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial (Gene Name=SIRT3)

[Back to BioLiP]