Structure of PDB 5z98 Chain B Binding Site BS01

Receptor Information

>5z98 Chain B (length=182) Species: 9598 (Pan troglodytes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALLTAETFRLQFNNRRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKK
KCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWKLVDFIQAHDH
LNLRIFASRLYYHWCKPQQEGLRLLCGSQVPVEVMGLPEFNDCWENFVDH
EKPLSFDPCKMLEELDKNSRAIKRRLERIKQS

Ligand information

>5z98 Chain C (length=10) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cugccgggua

..........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5z98 Structural basis of chimpanzee APOBEC3H dimerization stabilized by double-stranded RNA.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	R16 R17 R18 R21 H114 R175 R176 R179
Binding residue (residue number reindexed from 1)	R15 R16 R17 R20 H113 R174 R175 R178

Enzymatic activity

Enzyme Commision number

3.5.4.38: single-stranded DNA cytosine deaminase.

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0008270	zinc ion binding
GO:0016787	hydrolase activity
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:5z98, PDBe:5z98, PDBj:5z98
PDBsum	5z98
PubMed	30060196
UniProt	B7T0U6

[Back to BioLiP]