Structure of PDB 5z12 Chain B Binding Site BS01

Receptor Information
>5z12 Chain B (length=217) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDMPVERILEAELAVEPKTENDPVTNICQAADKQLFTLVEWAKRIPHFSE
LPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAG
VGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEA
LREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKL
IGDTPIDTFLMEMLEAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z12 Structural insights into the heterodimeric complex of the nuclear receptors FXR and RXR
Resolution2.75 Å
Binding residue
(original residue number in PDB)		V280 K284 F450 E453 P458
Binding residue
(residue number reindexed from 1)		V39 K43 F209 E212 P217
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003707 nuclear steroid receptor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5z12, PDBe:5z12, PDBj:5z12
PDBsum5z12
PubMed29934308
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]