Structure of PDB 5yxj Chain B Binding Site BS01

Receptor Information
>5yxj Chain B (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATN
HVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKHSDLL
EERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYI
KDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHA
EMLMSWRHKFTPLLCEIWDV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yxj A ligand of drug binding to FXR
Resolution2.62 Å
Binding residue
(original residue number in PDB)		K303 H313 Q316 K321
Binding residue
(residue number reindexed from 1)		K60 H70 Q73 K78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
GO:0032052 bile acid binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0038183 bile acid signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5yxj, PDBe:5yxj, PDBj:5yxj
PDBsum5yxj
PubMed
UniProtQ96RI1|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]