Structure of PDB 5yeh Chain B Binding Site BS01

Receptor Information
>5yeh Chain B (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHM
RTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIAR
KSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yeh Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites
Resolution2.328 Å
Binding residue
(original residue number in PDB)		Y358 R368 S372 R377 R389 K393 R396 H397 T400 K405 T417 Q418 T421 K429 R448 D451 Q459 R479
Binding residue
(residue number reindexed from 1)		Y10 R20 S24 R29 R41 K45 R48 H49 T52 K57 T69 Q70 T73 K81 R100 D103 Q111 R131
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5yeh, PDBe:5yeh, PDBj:5yeh
PDBsum5yeh
PubMed29076501
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]