Structure of PDB 5ye3 Chain B Binding Site BS01

Receptor Information
>5ye3 Chain B (length=211) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELKKPGETVKISCKASGYTFTDYSMHWVKQAPGKGLKWMGW
INTATGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCGRDY
WGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTV
TWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPAS
STTVDKKLEPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ye3 JQ1 affects BRD2-dependent and independent transcription regulation without disrupting H4-hyperacetylated chromatin states.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		I2 Y27 Y32 S33 H35 R98 D99 Y100
Binding residue
(residue number reindexed from 1)		I2 Y27 Y32 S33 H35 R98 D99 Y100
External links